- Recombinant Rat Uncharacterized protein ZMYM6NB (Zmym6nb)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1087471
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,396 Da
- E Coli or Yeast
- 22-152
- ZMYM6 neighbor
- Uncharacterized protein ZMYM6NB (Zmym6nb)
Sequence
AKLFQVSAPVSQQMKALFEQFAEVFPLKVLGYQPDPISYQAAVGWLELLAGLLLVVGPPVLQQISNVLLILLMMGAVFTLVVLEESLSTYIPAVVCLGLLLLLDSCQFLVRTKGAVRCRNKIPGALGNPRK